DPCstruct | MC27611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 157 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 19.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07087 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519YZ15 | 15-147 | LSACTTIAPTRAPLLSPFGDGTQWIVWEDMQFVAKLNDHTQLSIIVPRGFVTDLASTPKEIWSIYPPFGKYLSAAILHDYLYWRQEC… |
| Q9AAP9 | 5-126 | PLVVAVLDSEDEKEGRTCAIVAFGFRYIHPASGAQVDVPEGYVTDFASIPAPVRGLFPPFGRHAKAAVLHDWLYLIGEPGQRAFADR… |
| A0A1L3SPB7 | 10-120 | None |
| A0A848UI30 | 28-208 | None |
| A0A0F9F4H9 | 5-128 | None |
| A0A1H0UUY5 | 12-134 | None |
| A0A5N5ZBJ3 | 162-307 | None |
| A0A6B1HK94 | 106-240 | None |
| A0A8B4FZ23 | 161-289 | None |
| A0A2E6QB20 | 28-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.