DPCstruct | MC2761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 191 ± 20 aa |
| Standard deviation of domain lengths | 20.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4UXD1 | 8-195 | LLLALSIYAKVWGKGRGIELLFDDPFSPQKPYAGFLTGISEVLWCLTAAICAFSFSLLKSIYRRPDRFIFCSALGIGILLVDDLFRL… |
| A0A7G8F809 | 16-202 | ALSVYVAALSLSNMAGIKAQSVLRDLAQTCSTPAGVGLLSNLGYLLWLAAAAVALFTAHSRLPGIRGKQLQLLACGGWFSLILCIDD… |
| A0A2H3NJQ1 | 9-190 | None |
| A0A1H1ZX16 | 34-217 | None |
| S9QJB9 | 2-144 | None |
| A0A2T1BX56 | 21-232 | None |
| A0A5S4ZH90 | 1-192 | None |
| A0A3S1FGC7 | 58-263 | None |
| A0A6H1U5U8 | 6-180 | None |
| A0A419GX49 | 11-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.