DPCstruct | MC27605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 13.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2NUW8 | 109-226 | RWRIPAEFPCCPTELTETPLQDYFENLKQGKIFSKTKQYSSSVLETALHEDMIIVKGESREINAIKPWSLCTITFENNLFVHRVYMT… |
| A0A7J0AKY3 | 37-165 | IQYFDSLTPTAKQIAWRTPTEFPLCPLDRERLSLEKYFSNLSIGKIITKNEYGCHFVDDYRLVNDKLYIRTHTADGIKPYSLITVTL… |
| A0A7D9H452 | 242-375 | None |
| A0A1J5M6Z4 | 313-440 | None |
| A0A7Z7D225 | 22-146 | None |
| A0A329ZTR7 | 60-208 | None |
| A0A1V9FZ91 | 15-130 | None |
| A0A0Q7HXX1 | 1-93 | None |
| A0A849FFJ4 | 39-172 | None |
| A0A6N4RBI0 | 206-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.