DPCstruct | MC27604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 156 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5H684 | 88-238 | LNIVVSTISFEYEPCAFEKSNELSVMGKEGRYMKEKFENINSILAGINDFKGNVKLVFEKLDLDKISFSNIRKKDAVAIANEIDRLV… |
| A0A7J0AE83 | 1-165 | MPVAISYEYDPNDYLKAREFLLRKRDPEFKKSQRDDLFSMETGLLQQKGHVHLSLTEPMNPHIDAIAPDADKATIVSQVCSDIDNAI… |
| A0A160TBN7 | 158-313 | None |
| A0A2E6JNB6 | 232-358 | None |
| A0A7Y2EN69 | 132-299 | None |
| A0A2N2ZUR5 | 37-207 | None |
| A0A3C1NWD8 | 1-175 | None |
| A0A7X6T6D7 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.