DPCstruct | MC27601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 290 ± 27 aa |
| Standard deviation of domain lengths | 27.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3BMU9 | 20-299 | TRDALLHTLSSRTKNFGILEDDEEQRLHETFDSLCADNNGPRYLSQPAFVSFLQRSGFLPSSMNEAGAILYRSLINISQAPFYQHSA… |
| A0A830INX2 | 8-282 | SSSSRVKKYLDEVTRESVLDNLNETLAPHWAGAKDVWNIFFLHTFQDGFDHYWDVESFRRFLASQHRGIASQEPVYLLWRCLHFYAH… |
| A0A4Q7K5V6 | 630-935 | None |
| A0A094GSH5 | 464-758 | None |
| E4UQW5 | 14-310 | None |
| A0A1L9WRS7 | 1-255 | None |
| A0A421JR85 | 241-567 | None |
| A0A225ANH2 | 274-598 | None |
| A0A6P8APK2 | 1-327 | None |
| A0A6A6NR45 | 1-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.