DPCstruct | MC27600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 348 ± 41 aa |
| Standard deviation of domain lengths | 40.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830IB56 | 63-432 | MAAFSIGQAPYNNATDMPHDGWRKFLPFVINLYKTGTATVSREGITTWYRKSPAAACSTGGTSGNTASQLQLELPPTDVAQDRIFFT… |
| A0A1M3TTC1 | 198-526 | LSPMHIGEAPFNYVENMPHDGWRLFLPFVIDMYKQNVTTVTQEGLVTWLRPQPIGACDGGNTTINTASQLEIEFEPASVLTDEIFFS… |
| A0A135V3K5 | 257-508 | None |
| A0A370P6Z1 | 229-593 | None |
| A0A1V6SCR4 | 265-629 | None |
| A0A2V1DQ76 | 25-391 | None |
| A0A3D8QA89 | 27-359 | None |
| A0A3D8T2Y4 | 236-656 | None |
| T0LVD0 | 116-376 | None |
| A0A066XHZ4 | 225-631 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.