DPCstruct | MC2760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1CPS7 | 16-110 | QEAFISYSEYGQMLYQNPRGISCVQCHGKNGEGISIIKYKEGDKLKELRGADIRNMNLISMQKALNAYHKVMPRYYLTNKEIEAIYD… |
| A0A7M1S6E1 | 1-83 | MLYNNPRGVSCAQCHGAKGEGKIIVEFRDIHGKQTLRGSDIRLKSLEQMRNSVNRYHPVMPRYYLTDEEVKAIYDYLQVKNAD |
| A0A6S6SL05 | 34-139 | None |
| A0A4P9DXD9 | 1-90 | None |
| J5KQQ2 | 16-118 | None |
| V8CCU4 | 172-265 | None |
| A0A2N6G104 | 4-100 | None |
| A0A7S9X6I4 | 17-116 | None |
| V8CI76 | 50-150 | None |
| A0A4Q0XWS5 | 11-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.