DPCstruct | MC27598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 19.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 94.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8Y0N3 | 130-298 | STNAYKYSNGSDIPSIREFVNGTQQVLASTATENHWELTFGTSSRSSLQWDIWNAVFGVQGLNGYPLEPWNKVTGEIYPEAVKYWES… |
| A0A3B8UZB0 | 2-155 | MTIPEEIGMERALAPDFTSGEQWAAWNAMFSGRDAASGLPLAAFDLETGLIDRTVIERDWSRYDIAAMLRADPERIAAVFRDKVRLL… |
| A0A1Q7JRQ5 | 408-547 | None |
| A0A3C0WIF7 | 189-318 | None |
| A0A7Y5NG59 | 29-188 | None |
| A0A5C6DP01 | 43-159 | None |
| A0A7W6LTB5 | 17-136 | None |
| A0A3R7J3S3 | 473-638 | None |
| A0A7X4D4A7 | 1-135 | None |
| A0A523NHC5 | 748-903 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.