DPCstruct | MC27595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 324 ± 42 aa |
| Standard deviation of domain lengths | 41.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2B4F0 | 279-663 | GRKDWLALQVDFPNEEFTSRPPRYTLWPGRTIELDQVRDESGAERADLRIEVLEVYDHAEVGLVKVHESSDPDAEPLALAELLLDRG… |
| A0A3A4PX06 | 40-368 | LDLTPSMEPVELDVGVTMPSPWPSPRITRYLSQAVVTQLVVPAGEGDGRAAALLVLEGPKQTYERWLLADDPTRNRLVSLIGFWRFM… |
| A0A2D5BVN1 | 323-648 | None |
| A0A660UQ54 | 1-288 | None |
| A0A2V5VGP3 | 151-553 | None |
| A0A838EYU4 | 12-308 | None |
| A0A832M674 | 307-666 | None |
| A0A1G2Z4I6 | 3-326 | None |
| A0A2E2U7Z8 | 148-419 | None |
| A0A2V5NGH2 | 148-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.