DPCstruct | MC27590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 28.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067CZQ4 | 211-296 | LPPRAIDDCGVCNAHNSANWNLACRGCDNILHSNKTIDVCGVCGGDGSFDICGECLPAKDKRRDTICADCKGEPWGPATRDACGVC |
| A0A382I545 | 151-284 | VEDCTGECGGTVVEGECGVCGGSGIPEGACDCDGNVDLGCGCGETGPSGCDETCGSELEFDECGVCGGSGISDGDCDCNGNLDLGCG… |
| A0A7S1EAG7 | 336-471 | None |
| T1K599 | 1-110 | None |
| A0A2E5U418 | 288-392 | None |
| A0A2E1X0E6 | 47-165 | None |
| A0A1Z9M2S9 | 24-123 | None |
| A0A7S4HC03 | 1065-1201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.