DPCstruct | MC27585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 81 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.00 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0163- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7IAE6 | 1-67 | MGKYTTAEEALKVIKSNDYVYVHGGAAVPSHLVEALTARAPELRGVTICHIHTEGDAPYADPKYRDS |
| A0A0M1YY03 | 1-65 | MKDKFISANSALFSVKSSQRVFVHSVAAAPALLIDALTARADELSDVEIIHLHTEGKAPYAEIIF |
| A0A832GEH2 | 19-73 | None |
| A0A507FL12 | 6-113 | None |
| A0A1I8ISG4 | 304-383 | None |
| A0A044VJ23 | 34-119 | None |
| A0A0N4WID3 | 18-96 | None |
| A0A183ULU4 | 32-114 | None |
| A0A820ZXK0 | 6-69 | None |
| A0A8B6EXG2 | 782-873 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.