DPCstruct | MC27584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 244 ± 53 aa |
| Standard deviation of domain lengths | 53.00 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.42 |
| Pfam Score | 88.36 |
| Assigned Pfam label(s) | PF19295- PF01458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9S365 | 2-207 | EIDIGEGARLNHYKVQAETLDATHLSTTHVHVAKDATYEYFNLSIGGRLSRNEVSVRLEGEGAHAGLNGAYLMRGSEHCDNTTMIEH… |
| A0A847XIH8 | 38-271 | EWTHNYFVKKPEQGFFLWVKESIFSQINTLVEIDSKNVFQKMNNLIVIEKGIKAKLFSTCKSLKEVKGKHFAKAKIIIKKNSFLEFL… |
| E1IDT8 | 382-652 | None |
| B8D603 | 87-255 | None |
| A0A7H4SIM4 | 9-206 | None |
| A0A1H3GGZ1 | 93-379 | None |
| A0A7C5N159 | 44-332 | None |
| A0A326GEY9 | 32-165 | None |
| A0A381GMS1 | 10-314 | None |
| A0A1B0C170 | 237-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.