DPCstruct | MC2758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 66 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 51.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A563W2C8 | 1-48 | MKEKNFFNSACRHCRHYQPEGRRGGSCQQLGVSVDSSWKACILASAPF |
| A0A355CCK5 | 1-51 | MNTSLTSACRHCRHYTPEGRRGGNCQQLSVPVQSHWKACSLAVSPFGPSWE |
| F5UIV8 | 21-84 | None |
| A0A6P0TF57 | 1-55 | None |
| A0A433W7Q4 | 1-101 | None |
| A0A352AFF0 | 24-78 | None |
| A0A068N0W8 | 35-102 | None |
| A0A2A2TIA0 | 1-70 | None |
| A0A7C9PRA3 | 41-128 | None |
| A0A3M1SRN7 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.