DPCstruct | MC27579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0ZU06 | 1-92 | GNGLLALMLWWLPARIQLLWLIFIFAWYPHHPANERSRYRHTRVAVFPGSGLLIRGHDHHAMHHLFPRVPHYRLKALWRELSAEMVQ… |
| A0A258E8J4 | 12-109 | GTFFGMAWSGYAIEVALLWWLPRQVGLSWIRYWLSWAPHHPQERGRYKNTKIFKAKLGYWASMAMEYHLIHHLYPGIPNHRQKEAYH… |
| X6MDK3 | 83-198 | None |
| A0A7Y9J6H2 | 169-291 | None |
| A0A6J7M5X1 | 101-200 | None |
| A0A832H2C5 | 19-126 | None |
| A0A7C7SD90 | 40-150 | None |
| A0A7W9W6G1 | 508-615 | None |
| A0A7G8JJM8 | 71-179 | None |
| A0A662DR96 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.