DPCstruct | MC27578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 62.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EIS0 | 1-60 | PNLASTNVKYKLADHRYGREEMLALFTHSDEAPDQLKEHPIYSADALVPLALLPQTEEEQ |
| A0A2K5PX00 | 14-91 | LLLRALSSGGSITSPPLSPALPKYKLADYRYGREEMLALFLKDNKIPSDLLDKEFLPILQEESLPPLALVPFTEEEQR |
| A0A4W4G8E1 | 15-91 | None |
| A0A3Q0IY19 | 1-95 | None |
| A0A6I9YTT1 | 13-89 | None |
| A0A6H5ILE2 | 1-93 | None |
| D2H846 | 40-126 | None |
| S9XMA7 | 58-143 | None |
| A0A4W6EBM0 | 49-127 | None |
| A0A4W5KS13 | 43-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.