DPCstruct | MC27576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6Z0L0 | 1-53 | MTQEQKVIRAKVGMLELARQLGNVSQACRVMGYSRDSFYRFKELYDKGGEAAL |
| F4VIS4 | 1-83 | MLHTTNPVIKHKAGLLNLAEELSNVSKACKIMGVSRDTFYRYHELADESGVDALINRSRRLLTLRTVPMRQLNRLLLITPSLS |
| A0A179D4B5 | 1-74 | None |
| A0A3Q8T8G6 | 8-76 | None |
| A0A1B9MCT1 | 1-53 | None |
| A0A1B9M6A9 | 1-52 | None |
| Q7N886 | 1-66 | None |
| A0A0S2SH34 | 1-70 | None |
| A0A1H0W2T4 | 1-63 | None |
| A0A1F3LVD0 | 21-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.