DPCstruct | MC27573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 169 ± 22 aa |
| Standard deviation of domain lengths | 21.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383RAB7 | 8-178 | YSYGDFCWIDFDEITTLDKLEPYEKAELLYLGHYKQPLRSPFFEKLNNKFVYLAHDDGWFNKIFYKDKNQYIDVLASLVSNRLKSYR… |
| A0A1G8C506 | 64-240 | EIIPNIINTDVYKFGDFCWVDFTDIESLGTLEPREVAELLYLGHMMKPVASPFFDKLNNRFSYLAHDDGWFNTFYSRNLREFEHIIG… |
| A0A2K9E8V1 | 30-168 | None |
| A0A383TFX6 | 15-152 | None |
| K8ZQP3 | 25-209 | None |
| A0A2D5B334 | 5-218 | None |
| A0A7X3II26 | 1-152 | None |
| A0A1Y0VT77 | 1-157 | None |
| S4B4L3 | 11-189 | None |
| A0A6B1R9A6 | 13-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.