DPCstruct | MC27570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 12.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2EXY7 | 3-94 | VIEWLEKWYAKQCDGLWEDDHGVDITTMNNPGWQVRIELHGTPYSDIEVAWTAEENSETDWFGYKFEFAVFDAIGDPSKLKFLLEQF… |
| A0A2T5TWB7 | 2-97 | QWYVSQCDEDWEHQYGVTIDTLDNPGWSLKVDLDGTPLEGLAFLPLYEGVSAEVQPGQGLDGDVPWLICRVEGSKFKGWGGPRDLAR… |
| A0A829C1Q2 | 10-124 | None |
| A0A0Q8VGN5 | 2-82 | None |
| A0A486XSQ6 | 104-210 | None |
| A0A7W9IGG6 | 2-75 | None |
| A0A7V5CBP7 | 99-192 | None |
| A0A102LX80 | 52-140 | None |
| A0A250J5I3 | 133-233 | None |
| A0A1V4GGV9 | 5-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.