DPCstruct | MC2757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 194 ± 29 aa |
| Standard deviation of domain lengths | 28.91 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9FQZ7 | 4-221 | TLRHYFIGSLLSWGLASTTLAQSLPIPVPGPSKNTQQKAQADERRKAFQTYLESDPDYQLLKAVPADRNEDQPELREKHEIVITMDP… |
| A0A7Y3MP99 | 66-219 | EDRGEMGLPPNKFYEQEWLYTSDPALLRPAPEKVHKLQEQLKNNPLMRTPPGTGSNTWVERGPNNVGGRTHTLMFAPGSTIKVFAGS… |
| A0A7X4AEG1 | 36-189 | None |
| A0A538DD99 | 23-218 | None |
| A0A7C7SZK5 | 3-222 | None |
| A0A534N3Z3 | 9-242 | None |
| A0A7Y5G9V9 | 1-188 | None |
| A0A1F3NWZ4 | 1-223 | None |
| A0A1N7E7V4 | 2-188 | None |
| A0A2V5WV09 | 4-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.