DPCstruct | MC27562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183KWV2 | 84-175 | NNDLRVGPPVYFVITEGHNFTTLDGQNQVCGGTGCYNTSLLEKISSAALYPNRSWIVSPASSWIDDYFDWIDPSGSSLCCRINRNTH… |
| A0A7R9I8I0 | 1-105 | MDDLLSMGPPVYFVVKSGVNFSSSTVQNMVCGSAGCNSDSLSAQLSTAVLESSETYLIRTPSSWLDDFFDWSTYQGCCMAYPNGSFC… |
| A0A183N619 | 336-445 | None |
| A0A2G5UFK4 | 90-183 | None |
| A0A183TBY7 | 58-166 | None |
| A0A3P8J4N2 | 258-354 | None |
| A0A821ZSX5 | 119-217 | None |
| A0A453CMM2 | 59-175 | None |
| A0A453CMM4 | 180-280 | None |
| A0A7R8ZNF9 | 374-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.