DPCstruct | MC27561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 7.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H6Q7 | 1-52 | IRPCLIYKDEYSECTSIKGRFHQYFIHGENQDCSQWKKDFDNCIAYNESDQR |
| E2AMB6 | 4-72 | AKEKQKNHENSWMIRPCMMYKAEYDDCTSIKVRFNQYFIFGETLDCSQWKTDYANCYEWEKNKSEKAYV |
| A0A670ZRF9 | 1-70 | None |
| R7TH32 | 2-73 | None |
| A0A7R9JTE9 | 21-77 | None |
| A0A7J7KB93 | 3-63 | None |
| A0A7T8H223 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.