DPCstruct | MC27558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 172 ± 21 aa |
| Standard deviation of domain lengths | 21.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15928 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9HYN0 | 27-198 | TVARRKRVWVHQEGGMFVSFLQRYSKAPEVPAMWTASTPRAKARAIYQFFPKFCEQFALPEPIPLPPHLTLIFDTVKKTDVVECALE… |
| A0A6J1W8F9 | 227-386 | VPGIFVPKDRHQRAAALDLLFPKMVGAVLEPPAVAEPPHVAMIFGAWQRRAVLAAAAAPRVSSRVLRCGFFADADVNEPKLLCKTVD… |
| A0A811V3A1 | 125-308 | None |
| U4TTM0 | 304-449 | None |
| A0A194QY99 | 29-222 | None |
| A0A139WH38 | 294-463 | None |
| A0A653CAY6 | 264-415 | None |
| A0A6J1LK06 | 25-193 | None |
| A0A194QCQ4 | 152-344 | None |
| A0A811W730 | 768-924 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.