DPCstruct | MC27557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 113 ± 20 aa |
| Standard deviation of domain lengths | 20.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0684 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0Y3W4 | 75-212 | TKQEKEEVAAFTACFSRQWRAGKSEAEVHSFKLSQIYKTKQMKEGTWGVRGVVAKQNAKLELALTRQEGVLRAVPTGTITRGSAWKA… |
| A0A843J2Y1 | 36-150 | QVSKTAESGEFVARGAFVIRGERRYFRDVAAGLAIGLQYEPAVAVIGGPITAVKTRARYCVTLQPGQYEPNDAAKKVLKALKNMVPE… |
| A0A836RVU8 | 95-219 | None |
| Q8PVZ1 | 133-263 | None |
| A0A7J2V8S9 | 254-383 | None |
| A0A7K3YU17 | 39-161 | None |
| A0A2H9PUT3 | 1-75 | None |
| A0A7J2KB36 | 395-523 | None |
| A0A2H9NG99 | 460-567 | None |
| A0A7J4FKP5 | 268-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.