DPCstruct | MC27556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 126 ± 23 aa |
| Standard deviation of domain lengths | 23.22 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845YCE9 | 2-104 | SQAASIIEAMEAGAQVLLIDEDTAATNLMIRDRNMQALIAKDKEPITPFIDKVRQLYSDYGISTVLIMGGSGDYFEVADCIITLDNY… |
| A0A843J1Y2 | 1-129 | FKSLSKGTSGTPANVTGRGSGSMGMAAQFTAALRRRASLIIIDEDKSATNLLVPNCIQSSDVTPLSVICKNERDKLGDSSVLFAAAT… |
| A0A7C7R1T3 | 275-377 | None |
| A0A6U1P3D5 | 25-136 | None |
| A0A812I1X5 | 135-280 | None |
| A0A4S4LTR3 | 438-570 | None |
| W7T242 | 73-225 | None |
| U7MXV7 | 49-166 | None |
| A0A5J4YM71 | 2-80 | None |
| A0A843CV12 | 317-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.