DPCstruct | MC27555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6LBV9 | 20-80 | LTGKICSEFTVPESHHTTGVPDTDFVLYVAAGSTELGVNAWAVKCQLDASGRPIVGVANIG |
| W6LD33 | 56-115 | LTGALCPHFTIPQSHHTTGVPDTDFVLYVAAGPTVPGIVAWAIYCQLDPSGRPLVGVANF |
| A0A7J6XRS0 | 1-66 | None |
| A0A7J6XID3 | 225-285 | None |
| V5APB3 | 73-135 | None |
| A0A3R7L756 | 23-88 | None |
| A0A061J6R3 | 153-215 | None |
| A0A453HAL4 | 37-94 | None |
| A0A061ITT2 | 223-284 | None |
| G0R6N1 | 8-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.