DPCstruct | MC27552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4LP06 | 677-739 | LQSMLLQSDGTKIFLLPAWPENWDVSFKLCAAYNTTVECEYRDGKVQFLHVSPESRRNDIVDM |
| A0A3G3GXD6 | 1-60 | MLMQTVGDTIYLLPAWPKNWDVDFKLHAPKNTTITGTVKQGKLMKLEVFPKMRRTNIKVM |
| A0A348V465 | 8-67 | None |
| A0A369QG60 | 163-221 | None |
| A0A519P8V1 | 1-57 | None |
| A0A7X7L5W6 | 334-392 | None |
| A0A1V4HMS7 | 697-759 | None |
| A0A839NM47 | 85-141 | None |
| A0A4R8DHB7 | 1068-1126 | None |
| A0A522R7C6 | 428-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.