DPCstruct | MC27548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 191 ± 12 aa |
| Standard deviation of domain lengths | 12.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8L5G2 | 373-564 | DRINVDTVHLVEYLTVAETAERLGVKRETVYAYASRGLLTSVRGAQRRGSRFAQDEVEALAARGREAGEPSGTVERIRTRITLVADG… |
| A0A087LKX1 | 1-184 | MIERVNVLALDWLTSAEALAVLGTQPQTLYANVSRGRIRAKKDPDDPRRSLYSGEDVRRLADRSPGRRKAESVASDAIRWGEPILKT… |
| A0A7K0DDU6 | 1-214 | None |
| A0A2V7YEY6 | 185-381 | None |
| A0A258JD30 | 2-196 | None |
| A0A6L5FIX5 | 6-198 | None |
| F1YFV4 | 1-168 | None |
| A0A3S0LBS3 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.