DPCstruct | MC27541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 166 ± 30 aa |
| Standard deviation of domain lengths | 29.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D8AVP9 | 270-391 | SDAPSVAQVFWDSGQGLREADSARQNHEPHRGLQTLRFTLPEGPLRALRFDPRDNPGGVEIRGIRLVDAGQRTRAVLPLDSLRTERD… |
| A0A3M9ZHH1 | 59-216 | AGLLQAISQQALKLEATETILPGQANLHLDLGQGFPSGSSLSTPLYRNLEGRTYIKLEATQDGIQAICFEPFDLPAILQIDCIQLTY… |
| R5ZYG6 | 348-531 | None |
| A0A3S3QWZ5 | 229-348 | None |
| A0A1V5A8E8 | 496-713 | None |
| A0A412J527 | 74-292 | None |
| A0A1M6T541 | 279-499 | None |
| M1P6E8 | 2-145 | None |
| A0A7X1GNK8 | 293-504 | None |
| A0A7C1N983 | 1072-1246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.