DPCstruct | MC27538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9Z1W9 | 3-136 | QNPGNLRLGWLYSSQSSTDFSNPVNTFGRNGFIDFRDPIRTQDGAFMVYANFDQYLFTVDTTERNPDLKFATPRGLGLFGRFGSGPE… |
| A0A1E3W2A8 | 14-135 | ELPGTIKIGGWNHFGDFEHLYVDAGGNPIAISGNNGKPLDNDYALYVILDQLLWHAPGTEEGQGLGFFTRFAGAPDDRNYVDFYFDV… |
| A0A534UQR8 | 38-138 | None |
| A0A562KCC4 | 65-184 | None |
| A0A6I1ITQ7 | 80-194 | None |
| A0A4R3SXW1 | 3-116 | None |
| A0A5E5QVA2 | 64-186 | None |
| A0A365VMP1 | 20-141 | None |
| A0A2V7D8U7 | 137-243 | None |
| A0A485BVU6 | 213-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.