DPCstruct | MC27537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9YY98 | 1-88 | MTLWRLISQELLSQADGDVLFLWKSDDDFAADAGQDTPLRRLKADPLWSQLKAVQQNRVYEVPGHWLGFGPIAANAVVDDLFTYLLQE |
| A0A455UBS1 | 45-120 | STENIPVLEADVLFILLEPDDPAIADNYQHWQAHPLWQQLSAVQHGRVFEVDPVSWMMGGGILAANAMLDDLYTHY |
| A0A841VFZ6 | 1-76 | None |
| H0U4N6 | 113-198 | None |
| A0A1Z3HNB1 | 25-97 | None |
| W5XRS4 | 8-88 | None |
| A0A3G9IWF2 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.