DPCstruct | MC27536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 477 ± 41 aa |
| Standard deviation of domain lengths | 40.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 28.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4GAW9 | 238-683 | ADGVFVADDGSAFGTGTRDDPFNSINAGIRAARAAGLRFVYVSAGNYLEAVSLADGVQVHGGYLRRSGWTRDGTLAVVRGPRTGALL… |
| A0A150QPZ6 | 1-458 | MFASASAEPGGDGTKDKPYASLAEAVAKAGGKRVLACTSGAFAESVTIEAGLKVIGGFDCAAEWTWSAEARSAIEGPAGQIALTMTG… |
| A0A5B8XN88 | 427-866 | None |
| A0A6N2DCB0 | 766-1244 | None |
| A0A368XPP0 | 17-560 | None |
| A0A838INM9 | 149-612 | None |
| A0A0F6YG51 | 689-1163 | None |
| A0A7X9J068 | 230-782 | None |
| F4PS52 | 115-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.