DPCstruct | MC27534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 9.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109MX92 | 1-120 | MAKLIHIQNQFLGQKSDGDRTYNVYKTTIKYSSKQMTIPFDMKLGLSREPEEGDVISSLVLDMWAYESVADFKNFCNELGYDTDDRR… |
| A0A7V2SSX6 | 10-145 | KWLKETGSSLKIEFVALDYHFSNDKEKRNIFDVTLSNKKGHYRFRFGTSINNTYRKTFNGQLIHIKKKPTNYSILASLGFYYPSDFD… |
| A0A7W1GZ55 | 26-155 | None |
| A0A497MW06 | 15-140 | None |
| A0A5R9NYY3 | 3-116 | None |
| G1UXH8 | 15-146 | None |
| A0A6N2V1H9 | 17-142 | None |
| A0LGA6 | 1-140 | None |
| A0A164QMV2 | 7-126 | None |
| A0A5E4HRM4 | 5-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.