DPCstruct | MC2753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 204 ± 27 aa |
| Standard deviation of domain lengths | 26.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z2GRS3 | 5-201 | EPGVIDAFNDYMRETAADNGVTYQPFAFGSGDRDLADYLLSSESRYVLVEFKDSEDDLNSERKKPKRLKLCKALEHEPSIAKLHDRC… |
| G0B007 | 2-184 | EYFWWEKTVEYVFVQKHVKIEMAVAPLGGVQEKGGDAILKNNDRWVLIEFKKGHDCISSEMDKFAPGKYNEAKVELEERGQHHLLVY… |
| A0A1I5KMN5 | 23-238 | None |
| A0A2D5JEV2 | 10-221 | None |
| A0A7X5MPI7 | 11-219 | None |
| A0A1Y0HL99 | 11-187 | None |
| A0A2U4H4P6 | 174-368 | None |
| A0A2I8F1I3 | 13-226 | None |
| A0A2J9SAD5 | 9-184 | None |
| A0A2V2BIQ3 | 8-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.