DPCstruct | MC27529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 11.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519HB26 | 28-105 | LPAVAGETAACALKASGTPPTVVETYTSEKCSSCPPIEAWLSTLAGDKSVLPLAFHVDYFDDKRWKDRYSNAAYTRRQ |
| A0A7C1QQQ9 | 1-97 | MLSKTLYRPFLIVFFGLIIFCFKSQAAEQVTISSTANPTTFLELYTSQGCSSCPPAEKWISKFTDDEKLWTDLIPINFHVTYWDYLG… |
| J6LIJ8 | 10-100 | None |
| A0A1G1NBR2 | 8-94 | None |
| A0A7W5ZUJ0 | 4-80 | None |
| A0A7Y5U0Z3 | 1-79 | None |
| A0A1Q7YPI8 | 5-104 | None |
| A0A1M7HJU5 | 111-203 | None |
| A0A1Y1Y5U7 | 1-121 | None |
| A0A561GCL9 | 6-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.