DPCstruct | MC27526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 6.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8JTH9 | 3-94 | TIKKPFFSDCVGWPREKVDLLHELVDEAQDIARSTFLAYADSETMRDMEVSLGYGKGFPMSKDWHVSYHVHRPTGIKYFKHSAIEYV… |
| A0A3D5EHH4 | 25-126 | KMSKRTYRFFNNCVSWDSADVHVDGGLCSLIDDRTSIERSTFLQYVDHDELQEIELSLGYSKHYKQGLTMAGDNHVEYFRSKHHGER… |
| S9RS21 | 3-116 | None |
| X7EBS7 | 2-91 | None |
| A0A7C7DMA3 | 2-91 | None |
| A2SNM3 | 4-103 | None |
| A0A4U0GG26 | 1-99 | None |
| A0A7W4QYL1 | 2-99 | None |
| A0A367U753 | 247-343 | None |
| A0A2T6B967 | 6-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.