DPCstruct | MC27523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 114 ± 2 aa |
| Standard deviation of domain lengths | 2.26 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 95.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V3JKW3 | 152-263 | AIFGSKNLKAVAIRGSHDLPVHDMDALVNTGDQAFDYLKSRDLFELWQQQGLMSVIDYINSVGAMPTHNFNDAHFDGADTINDDAML… |
| X1M9F6 | 1-116 | MASKNLKAIAVKGTGEITVNEPDKFKEVAKNAISYVRKSKANHTKYGTAQYTAIMNELGCYPTRNFQTGVFDGIDTITAEYMRENFF… |
| A0A7C2PZC8 | 59-174 | None |
| A0A520KU80 | 67-181 | None |
| A0A7X6XRS6 | 191-302 | None |
| A0A7C5HZE7 | 34-144 | None |
| A0A6V8PRB0 | 70-179 | None |
| A0A7X6AF11 | 16-131 | None |
| A0A662JF75 | 51-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.