DPCstruct | MC27522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 7.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M4WST9 | 39-104 | HHEQSLPWDEYNFVTVDRKRLMIITHRTDVTLGFEARFQHEVLFNKYLNFLHTVLPSTAEFTEKAW |
| A0A2P7P859 | 1-84 | MVRAERHENRSWDSIEEIVLWKKRRLIGLKMTFDKNHGGGTYSMYQKLYCKKGEVEKVLDFVKSVTSDIEFIERKLVVNSVSAE |
| A0A2N3PH45 | 25-110 | None |
| A0A3S0JWN5 | 73-153 | None |
| A0A0Q0ABX0 | 39-107 | None |
| A0A085DVS7 | 1-74 | None |
| A0A8A9A9L3 | 1-89 | None |
| A0A6B8QM39 | 104-183 | None |
| A0A0D6S2G8 | 42-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.