DPCstruct | MC27518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 112 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 40.81 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0123- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831HMA7 | 19-148 | PSLIHKTLLTASTIYDLKYLAQVLNDENGSNWSRASLKRQVTCIPEHCELSIADGRYLQTLIPSRPADYEDRHFSFIDLFAGIGGLR… |
| A0A2P7P307 | 2-97 | RQAGLSVAEAADLAGYDERTGYRWERGEAKPRKAVLEVLRAHTPAPPEDLSKPALFRFIDLFAGIGGLRRGFESIGGRCVFTSEWDK… |
| G4E573 | 6-124 | None |
| A0A3N0XC57 | 29-135 | None |
| A0A1H4F4D8 | 13-124 | None |
| A0A7W4GBI0 | 10-140 | None |
| A0A378AUR2 | 2-115 | None |
| A0A656YHV2 | 19-147 | None |
| A0A0K1J0F2 | 12-130 | None |
| A0A090VNH5 | 45-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.