DPCstruct | MC27516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376S3R8 | 11-91 | DTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYESWSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTA |
| A0A2P7P2K6 | 1-91 | GRRIRAVEGFGFHLATLDLRQNSAVHERVVAEMLAKAGVCDDYAALGEDARVMLLRQELATARPLTSPFADYSEETASELAIVRAAA… |
| A0A378W3L9 | 2-82 | None |
| A0A0A9DG36 | 81-167 | None |
| A0A656H776 | 126-209 | None |
| A0A379WI39 | 60-144 | None |
| A0A0B0NG86 | 35-123 | None |
| A0A5D2RL15 | 35-121 | None |
| A0A6A3BU54 | 102-173 | None |
| A0A6N2N478 | 3-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.