DPCstruct | MC27515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P7P2L2 | 1-91 | ADETCTGDSARRAGNEFLFQQLAMQNIEMLNSVFDGIEQKKRKIVVTCAHCFNALGNEYPEVGGDYEVVHHTQLLNRLVRQKKLIPV… |
| A0A7K2EG79 | 118-198 | LGPAEMCTGDPARRSGNEYVFQMLAMQNVETLNGLGVRKIITQCPHCFNTLGNEYPQLGGHYEVIHHSQLLEQLVDSGRLD |
| A0A6N4VS99 | 45-135 | None |
| A0A7I8BD14 | 253-342 | None |
| A0A173LRF9 | 533-622 | None |
| A0A2N9AM84 | 435-522 | None |
| A0A0M3C8Y2 | 3-85 | None |
| A0A7X8R7I7 | 459-544 | None |
| A0A511MWB3 | 469-549 | None |
| A0A7G7CRM2 | 452-544 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.