DPCstruct | MC27509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P7P0V3 | 1-81 | RMIKRWRLEPKPQDMARYKRGELVEPRDPIVFYIDPATPKKWVPYLIAGVNDWQKAFEKAGFKNAIIGKVAPTAKENPNWS |
| A0A090R044 | 148-224 | RWRLEVKDEDIAKFKAGELVEPKKQIVYYIDPATPQQWRKYIKQGIEDWQVAFEAAGFKNAIIAADAPTKEEDPDWS |
| R5JCW3 | 289-360 | None |
| A0A090X5A5 | 43-119 | None |
| A0A844N9K5 | 232-296 | None |
| A0A355XR38 | 144-211 | None |
| A0A840EGF4 | 68-139 | None |
| A0A432WUQ5 | 279-348 | None |
| A0A1I1QAN6 | 106-175 | None |
| A0A7W9SS19 | 560-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.