DPCstruct | MC27506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 4.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P7NZY3 | 1-76 | DAIDGLPPAVALQQQRGSANARSSVGSVTTLSSLVRMLYSRVGEYPRNQPMLYAEDFSPNTVAGACPTCHGIGRVY |
| K8E2T1 | 75-158 | DEIENLPVSIVINQKKIGGNARSTVGTVTDIYTSLRLLFSRIAKPFIGYSMVYSFNHPQGMCPLCKGLGETKEIDLAHLINFDK |
| A0A2X2KU89 | 34-118 | None |
| A0A6I4NII0 | 1-85 | None |
| W4UAN6 | 54-136 | None |
| A0A7W5WCG8 | 90-167 | None |
| A0A086MUK8 | 37-119 | None |
| A0A562MG42 | 76-144 | None |
| A0A3D9UZ76 | 49-127 | None |
| A0A417YYA4 | 9-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.