DPCstruct | MC27500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 7.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6ILK3 | 1-87 | MQMQQCSAHYMYCTANYQCGEGQLRCIDMIRYRECCTPIRRDCPPVTHLNFRCIVSEPVSWCDEDRDCHTTPQQKCCPTGCNYNICI |
| U4PBH6 | 76-162 | MQMQQCSAHYMYCTPNYQCGEGQLRCIDMTRYRECCAPTRRQCPPVTHLNFRCIVSEPVSWCDKDSDCHTTPQQSCCPTGCNYNICI |
| A0A158R3Y6 | 58-140 | None |
| A0A0N5AG13 | 96-183 | None |
| A0A0N4VX74 | 1-73 | None |
| A0A368FFB2 | 95-176 | None |
| A0A811LAJ3 | 59-144 | None |
| A0A2A6C0Y3 | 40-121 | None |
| G0MXS3 | 85-173 | None |
| E3LUR1 | 191-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.