DPCstruct | MC2750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 325 ± 34 aa |
| Standard deviation of domain lengths | 33.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267TMZ3 | 15-338 | SLYKKTFHQFYDHVSLVPEYEERNRILEEKEPTIILLDVLLEHQVYFHPWYEWCYHYFVAMGIEKQYFKAEHYPLNKEFIHNELEEL… |
| A0A4Q6AHZ9 | 8-327 | STLAFAEEAYKKLEGQENEVQYRLLQLLAEGQTTESFAVLKRLLLSSLPKTGNAILLQKPLLDSAELTATLFPDLLQKANDPLFGTV… |
| A0A4Q3SBN2 | 274-669 | None |
| A0A3S0D9V4 | 11-311 | None |
| A0A4Q5UHS0 | 862-1250 | None |
| A0A4U1CNV8 | 87-473 | None |
| A0A255R1F7 | 19-331 | None |
| A0A2T5S9A9 | 78-421 | None |
| A0A4Q3DJJ8 | 116-419 | None |
| A0A3C1R526 | 2-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.