DPCstruct | MC27498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 86 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3ZNY0 | 88-159 | LGVAVASEKDDLQSIKGIGPFIEEKLNALGIFTFEQVSKMTAKIEEEVNVAIEFFPGRVKRDEWAKQAKKLH |
| A0A4Q3J9S7 | 4-97 | AAPAAEPAASAVAESKPQLLTAARGGKGDDLELIWGVGPKLGRMLNEMGVWHFDQVAAWTPAELAWVDARLTGFKGRAVRDDWISQA… |
| A0A657LWR3 | 92-191 | None |
| A0A7R7CED6 | 452-537 | None |
| A0A7R7YDQ5 | 131-224 | None |
| A0A7V5BEA3 | 204-277 | None |
| A0A1I7N9K4 | 204-273 | None |
| A0A3D4DQ65 | 167-256 | None |
| A0A350XQ71 | 463-539 | None |
| A0A6V8D5F6 | 444-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.