DPCstruct | MC27490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 170 ± 20 aa |
| Standard deviation of domain lengths | 20.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1VRS4 | 1-170 | MSDGGSSATSSGQHLSRDEKRAKALGIPLEVQDIINLPMDEFNERLSKHDLSEAQLSLIRDIRRRGKNKVAAQNCRKRKLDQITSLA… |
| A0A4W4HD58 | 142-309 | QTASPPSPPARGAHRNRSTCHDEQHARALCLPLSVDDIVGLSADAFNEAVGDNELSQAQLVLIRDIRRRGKNKMAAQSCRKRKLDKM… |
| A0A1S3NUR8 | 741-933 | None |
| A0A287A5D7 | 437-584 | None |
| A0A4W4E6M4 | 503-683 | None |
| A0A6I8P469 | 197-362 | None |
| A0A1W0X8E7 | 672-836 | None |
| A0A5J5CMV5 | 491-618 | None |
| S4RCN8 | 574-719 | None |
| A0A6P7XUP0 | 258-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.