DPCstruct | MC2749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512E4R2 | 40-168 | SLSRSIDANARAAQIEIFGGEVIVPATEQNRGTASAPTRGGTVVRAFWWGFHIQISHEDVQGVVSAIDGAKSLISAISPAAPAKVRP… |
| A0A409W5B4 | 514-640 | VPSDTKLSVQAMWWGYRLYLPPPVLEILDDKTLEATKRAAMITTALTWFFNNLPINSLPVAVRPALLLLQRIAPFVGYIGTFISWSW… |
| A0A543GCU9 | 5-116 | None |
| A0A1J8Q690 | 21-167 | None |
| A0A4S8MQI0 | 167-308 | None |
| A0A4P9Y7G1 | 50-168 | None |
| A0A146I9T3 | 535-681 | None |
| V2XDV8 | 314-464 | None |
| A0A1Y2GQT3 | 258-412 | None |
| X8JKL7 | 105-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.