DPCstruct | MC27488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 200 ± 35 aa |
| Standard deviation of domain lengths | 34.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.45 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF16002- PF15353 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5AX68 | 1-126 | MCVIGLPLPENFEDGVKMKCSNSSCKHQEQLIHLECFHALEENLIKIMSNIGSARGWTETQRRSNLWDKKGLTLIQKKCRCPCGLGL… |
| A0A2H1V1A1 | 1-195 | MAPRRQGATGEREAEEARGCCVPGECLRPREPVRIEDAVRVLCNNDTCAAGRYMHRECFEQWEAGVLAYLKSCGRARSWSERQRHQN… |
| A0A1W7RAG0 | 1-219 | None |
| T0MHX5 | 45-222 | None |
| F5HKX3 | 49-238 | None |
| A0A0M3IFF1 | 203-415 | None |
| A0A6A4K5I4 | 1-228 | None |
| A0A7E4VS46 | 51-239 | None |
| A0A7M7GJ60 | 1-236 | None |
| A0A1I7RP24 | 1-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.