DPCstruct | MC27485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 77.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0KS11 | 1-86 | VDKRLDAIDTPEALALKGKAAVANAQLAYELFGKKFSGARWEALAAKGAKVQRPLWASTSTKDPSYPTTLYVDSLIAPDTVNTMPE |
| A0A0D3AIU4 | 692-778 | DTLMDKMLEKIGTPEALDLRGKAAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTVSTM |
| A0A816I0G4 | 118-216 | None |
| A0A0U0WDP6 | 22-121 | None |
| A0A5P1E0M1 | 278-364 | None |
| A0A835V536 | 1040-1126 | None |
| A0A0D3B1C7 | 235-335 | None |
| A0A6A2Z9B9 | 128-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.