DPCstruct | MC27484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 154 ± 38 aa |
| Standard deviation of domain lengths | 37.58 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 38.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5ABU9 | 25-129 | ILTVAVYPSEFGLKRMAEEAVRGPALFGSDDESSEDDQDELENEKLRQYEKDRLRYYFAVIECDSSATSGYLYKACDGVEFERTSNV… |
| A0A183D6E2 | 1-203 | LARGNGNITSSDEDSDSEWELEEVVEEVHDWGETDKDARRVEWKSQRLALCNMEWDRISASDIFVLISSFKPPAPAAQSTVLIMTVK… |
| A0A811NJE5 | 194-389 | None |
| A0A0N5AUT4 | 1-119 | None |
| A0A4Y7NLL4 | 739-844 | None |
| A0A7J5ZXM4 | 163-366 | None |
| A0A505I0A0 | 4-197 | None |
| A0A194RH31 | 131-304 | None |
| A0A2D4PS55 | 279-456 | None |
| A0A284R9R7 | 108-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.